(data stored in ACNUC9543 zone)

EMBL: CP000308.PE91

CP000308.PE91        Location/Qualifiers
FT   CDS             complement(105632..106333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0091"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12060"
FT                   /db_xref="GOA:A0A0E1NRE2"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NRE2"
FT                   /protein_id="ABG12060.1"
FT                   /translation="MWITIAPFVTLPTIFFYHGYTSSKEVYSYFAYAFAQAGFRTISPD
FT                   ADMHGARFNGNETQRLSHFWEILKSNIDELPDLKRHYQQAGLIEGERIGVAGASMGGMT
FT                   ALGAFARYPWIRVAADFMGSGYFTSLAHSLFPPRDAGREISQQAFERRLAPLADYELTH
FT                   QLEKITERPLLVWHGEADDVVPAAESARLVQALRTRGGDNNLTYLTEAGIGHKITPTAL
FT                   RAGSDFFTQYL"
     MWITIAPFVT LPTIFFYHGY TSSKEVYSYF AYAFAQAGFR TISPDADMHG ARFNGNETQR        60
     LSHFWEILKS NIDELPDLKR HYQQAGLIEG ERIGVAGASM GGMTALGAFA RYPWIRVAAD       120
     FMGSGYFTSL AHSLFPPRDA GREISQQAFE RRLAPLADYE LTHQLEKITE RPLLVWHGEA       180
     DDVVPAAESA RLVQALRTRG GDNNLTYLTE AGIGHKITPT ALRAGSDFFT QYL              233
//

If you have problems or comments...

PBIL Back to PBIL home page