(data stored in ACNUC9543 zone)

EMBL: CP000308.PE93

CP000308.PE93        Location/Qualifiers
FT   CDS             107412..108191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0093"
FT                   /product="insertion sequence IS100, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12062"
FT                   /db_xref="GOA:Q1BZX6"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:Q1BZX6"
FT                   /protein_id="ABG12062.1"
FT                   /translation="MMELQHQRLMALAGQLQLESLISAAPALSQQAVDQEWSYMDFLEH
FT                   LLHEEKLARHQRKQAMYTRMAAFPAVKTFEEYDFTFATGAPQKQLQSLRSLSFIERNEN
FT                   IVLLGPSGVGKTHLAIAMGYEAVRAGIKVRFTTAADLLLQLSTAQRQGRYKTTLQRGVM
FT                   APRLLIIDEIGYLPFSQEEAKLFFQVIAKRYEKSAMILTSNLPFGQWDQTFAGDAALTS
FT                   AMLDRILHHSHVVQIKGESYRLRQKRKAGVIAEANPE"
     MMELQHQRLM ALAGQLQLES LISAAPALSQ QAVDQEWSYM DFLEHLLHEE KLARHQRKQA        60
     MYTRMAAFPA VKTFEEYDFT FATGAPQKQL QSLRSLSFIE RNENIVLLGP SGVGKTHLAI       120
     AMGYEAVRAG IKVRFTTAAD LLLQLSTAQR QGRYKTTLQR GVMAPRLLII DEIGYLPFSQ       180
     EEAKLFFQVI AKRYEKSAMI LTSNLPFGQW DQTFAGDAAL TSAMLDRILH HSHVVQIKGE       240
     SYRLRQKRKA GVIAEANPE                                                    259
//

If you have problems or comments...

PBIL Back to PBIL home page