(data stored in ACNUC7421 zone)

EMBL: CP000386.PE1

CP000386.PE1         Location/Qualifiers
FT   CDS             2..1354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: chy:CHY_2710 chromosomal replication
FT                   initiation protein; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator, DnaA-like Chromosomal replication initiator,
FT                   DnaA; SMART: ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABG02982"
FT                   /db_xref="GOA:Q1B046"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:Q1B046"
FT                   /protein_id="ABG02982.1"
FT                   /translation="MQSRAEEVWNEVLDRVSEHINAPSLKVWFEGTRPVQLYEDGLEIS
FT                   VPNTFAKEYIESRFRPLLEEALDGVLGQEETSIIVSVGGQGRRAGREETSAETGAESVL
FT                   SARTPRSLKAKYTFDSFVIGAGNRFAHAAALAVAENPGVVYNPLFIYGGVGLGKTHLLR
FT                   AVGHYVEDQDPTMRVRYVTCEQFTNDFINSMRDNAPLEFQKRYRENDVLLIDDIQFLEN
FT                   KVETQEAFFHTFNALYEENKQIVIASDRHPKYLQTLENRLVSRFEWGLVTDIQPPDLET
FT                   RIAILRKKAMMDRLEVDDEVLTFIASKVSTNIRELEGALVRILAYASLYGRQVTVALAE
FT                   EVLRDILPDSDYREIPIELIQHEVCRYFGISKEDLVGTSRSKAFAYPRQVAMYLSRELT
FT                   DESLPKIGKAFGGRDHSTVMHATNKIANLINSDRDTFNQIHEITYHIKSKR"
     MQSRAEEVWN EVLDRVSEHI NAPSLKVWFE GTRPVQLYED GLEISVPNTF AKEYIESRFR        60
     PLLEEALDGV LGQEETSIIV SVGGQGRRAG REETSAETGA ESVLSARTPR SLKAKYTFDS       120
     FVIGAGNRFA HAAALAVAEN PGVVYNPLFI YGGVGLGKTH LLRAVGHYVE DQDPTMRVRY       180
     VTCEQFTNDF INSMRDNAPL EFQKRYREND VLLIDDIQFL ENKVETQEAF FHTFNALYEE       240
     NKQIVIASDR HPKYLQTLEN RLVSRFEWGL VTDIQPPDLE TRIAILRKKA MMDRLEVDDE       300
     VLTFIASKVS TNIRELEGAL VRILAYASLY GRQVTVALAE EVLRDILPDS DYREIPIELI       360
     QHEVCRYFGI SKEDLVGTSR SKAFAYPRQV AMYLSRELTD ESLPKIGKAF GGRDHSTVMH       420
     ATNKIANLIN SDRDTFNQIH EITYHIKSKR                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page