(data stored in ACNUC7421 zone)

EMBL: CP000386.PE101

CP000386.PE101       Location/Qualifiers
FT   CDS             107722..109641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0103"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="PFAM: ATP-binding region, ATPase-like histidine
FT                   kinase A-like PAS fold-3 PAS fold-4 PAS fold; SMART: PAS
FT                   PAC motif; KEGG: gsu:GSU2388 sensory box histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03082"
FT                   /db_xref="GOA:Q1AZU6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZU6"
FT                   /protein_id="ABG03082.1"
FT                   /translation="MDPSSLQGYQPLVFYAAAAVAGALLAGLAALLLWRRGRPSRRRDA
FT                   LRAAAFEQAAEGMLLVSGDRVLEANAACAALLGRERGELAGMPLGELLAGGAGGVPLPP
FT                   GKRSWSGTLALRSGGGEPVECEAAASRVLAGGREAVCLALRDVTERRREEEKLRETESR
FT                   YRTLVEQVPAIVYIEDVQTQATLYDSPRIEEILGYPRDLCEREPLYWHRILYPEDRERV
FT                   LEAEREAVERGSFVLEYRVFAADGRVVWVRDEARLLRDESGEPRFWQGVISDITEQRRA
FT                   EDALRESEERYRSLVQLSPDGVAVESEGRFVYLNEAGARLLGASSPQEVLGQPVMERVH
FT                   PDCRENARRRARRLRRGERVELQEERWLRLDGREMDVEVSAAPVQYGGRPSAQLVLRDV
FT                   TGRKRAEREIVRQKAELARSNAELEQFAYLIAHDLRAPLRSMDGFAQILLEDCAPRLGP
FT                   DGREYLARIQRATRKMARMIDELLGLSRLARADIRREPVDLSAMARSIGEELRQGEPDR
FT                   RVEFIVAGGLAAEGDRRLLRVALANLLENAWKFTRRTPRPRIVFGRIERGGERVFFVRD
FT                   NGVGFDMAYAGKLFGPFQRLHAEEEFEGTGIGLAAVARVIERHGGRVWAEGAEGEGATF
FT                   YFTL"
     MDPSSLQGYQ PLVFYAAAAV AGALLAGLAA LLLWRRGRPS RRRDALRAAA FEQAAEGMLL        60
     VSGDRVLEAN AACAALLGRE RGELAGMPLG ELLAGGAGGV PLPPGKRSWS GTLALRSGGG       120
     EPVECEAAAS RVLAGGREAV CLALRDVTER RREEEKLRET ESRYRTLVEQ VPAIVYIEDV       180
     QTQATLYDSP RIEEILGYPR DLCEREPLYW HRILYPEDRE RVLEAEREAV ERGSFVLEYR       240
     VFAADGRVVW VRDEARLLRD ESGEPRFWQG VISDITEQRR AEDALRESEE RYRSLVQLSP       300
     DGVAVESEGR FVYLNEAGAR LLGASSPQEV LGQPVMERVH PDCRENARRR ARRLRRGERV       360
     ELQEERWLRL DGREMDVEVS AAPVQYGGRP SAQLVLRDVT GRKRAEREIV RQKAELARSN       420
     AELEQFAYLI AHDLRAPLRS MDGFAQILLE DCAPRLGPDG REYLARIQRA TRKMARMIDE       480
     LLGLSRLARA DIRREPVDLS AMARSIGEEL RQGEPDRRVE FIVAGGLAAE GDRRLLRVAL       540
     ANLLENAWKF TRRTPRPRIV FGRIERGGER VFFVRDNGVG FDMAYAGKLF GPFQRLHAEE       600
     EFEGTGIGLA AVARVIERHG GRVWAEGAEG EGATFYFTL                              639
//

If you have problems or comments...

PBIL Back to PBIL home page