(data stored in ACNUC7421 zone)

EMBL: CP000386.PE102

CP000386.PE102       Location/Qualifiers
FT   CDS             109681..110130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0104"
FT                   /product="UspA"
FT                   /note="PFAM: UspA; KEGG: bte:BTH_II1567 universal stress
FT                   protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03083"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZU5"
FT                   /protein_id="ABG03083.1"
FT                   /translation="MGAFPTRILLATDGSPDAERAGRVAVDLANSTGSELHVVTVARGL
FT                   DPAYFVHEYYYGFQEALEAFEEEARQVLEEQVRKLEEYGGRVAGAHLLTEQPKDRAIVR
FT                   LSEELGAGLIVMGSRGRGGLRRALMGSVSDSVVRHAHCPVLIVRS"
     MGAFPTRILL ATDGSPDAER AGRVAVDLAN STGSELHVVT VARGLDPAYF VHEYYYGFQE        60
     ALEAFEEEAR QVLEEQVRKL EEYGGRVAGA HLLTEQPKDR AIVRLSEELG AGLIVMGSRG       120
     RGGLRRALMG SVSDSVVRHA HCPVLIVRS                                         149
//

If you have problems or comments...

PBIL Back to PBIL home page