(data stored in ACNUC7421 zone)

EMBL: CP000386.PE105

CP000386.PE105       Location/Qualifiers
FT   CDS             112095..113561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0107"
FT                   /product="L-aspartate oxidase"
FT                   /EC_number="1.4.3.16"
FT                   /note="KEGG: ade:Adeh_3566 L-aspartate oxidase; TIGRFAM:
FT                   L-aspartate oxidase; PFAM: fumarate reductase/succinate
FT                   dehydrogenase flavoprotein-like HI0933-like protein FAD
FT                   dependent oxidoreductase FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03086"
FT                   /db_xref="GOA:Q1AZU2"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR005288"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZU2"
FT                   /protein_id="ABG03086.1"
FT                   /translation="MLAADVVVVGSGVAGCAAALAAARRGAEVVLLSKAPDPAETNTRH
FT                   AQGGIVYTGPGDSPEALVRDILAAGGGDRGAAELLAREGPPLVGRLLVEELGVPFDRGE
FT                   GGGLDLALEGAHSVPRILHCADATGEELQRALLRAVRAEPGVALLPGREALRLAVSGGR
FT                   CAGVCVAAGGRAGVLAGRCVVLAAGGLAGLYARTTNPPGATGDGCALALEAGARVRELH
FT                   YVQFHPTAFAGPGGEAFLISEAARGAGGVLRGPGGEEFIRHPAGSLAPRDVISHEICEM
FT                   MARTGSPCAYLDMTHLPEGLLRERFPGAYGRCLRAGVEMSREPVPVSPAAHYSCGGVAT
FT                   DLRGRSSLPGLFAAGEAASTGLHGANRLASTSLLEGLLFGWRAGEAAAEEARRLPPARP
FT                   PEAAADPPERAPGWAGEELGRILWEHAGPVRTVPSLREGLRRLRELREEVGPSSLDGPL
FT                   LVAETLVRQALSEGRSRGCHRLSDLEEVRS"
     MLAADVVVVG SGVAGCAAAL AAARRGAEVV LLSKAPDPAE TNTRHAQGGI VYTGPGDSPE        60
     ALVRDILAAG GGDRGAAELL AREGPPLVGR LLVEELGVPF DRGEGGGLDL ALEGAHSVPR       120
     ILHCADATGE ELQRALLRAV RAEPGVALLP GREALRLAVS GGRCAGVCVA AGGRAGVLAG       180
     RCVVLAAGGL AGLYARTTNP PGATGDGCAL ALEAGARVRE LHYVQFHPTA FAGPGGEAFL       240
     ISEAARGAGG VLRGPGGEEF IRHPAGSLAP RDVISHEICE MMARTGSPCA YLDMTHLPEG       300
     LLRERFPGAY GRCLRAGVEM SREPVPVSPA AHYSCGGVAT DLRGRSSLPG LFAAGEAAST       360
     GLHGANRLAS TSLLEGLLFG WRAGEAAAEE ARRLPPARPP EAAADPPERA PGWAGEELGR       420
     ILWEHAGPVR TVPSLREGLR RLRELREEVG PSSLDGPLLV AETLVRQALS EGRSRGCHRL       480
     SDLEEVRS                                                                488
//

If you have problems or comments...

PBIL Back to PBIL home page