(data stored in ACNUC7421 zone)

EMBL: CP000386.PE106

CP000386.PE106       Location/Qualifiers
FT   CDS             113558..113785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0108"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03087"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZU1"
FT                   /protein_id="ABG03087.1"
FT                   /translation="MTESVFESVAERYERAAGELERAAEHLRATAARFRDRDVPRGCAQ
FT                   ALAAQGRLRGAQRLLDELAALHASRAAPDL"
     MTESVFESVA ERYERAAGEL ERAAEHLRAT AARFRDRDVP RGCAQALAAQ GRLRGAQRLL        60
     DELAALHASR AAPDL                                                         75
//

If you have problems or comments...

PBIL Back to PBIL home page