(data stored in ACNUC7421 zone)

EMBL: CP000386.PE107

CP000386.PE107       Location/Qualifiers
FT   CDS             113800..114957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0109"
FT                   /product="aminotransferase, class V"
FT                   /note="PFAM: aminotransferase, class V aromatic amino acid
FT                   beta-eliminating lyase/threonine aldolase
FT                   Pyridoxal-dependent decarboxylase; KEGG: ade:Adeh_0592
FT                   aminotransferase, class V"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03088"
FT                   /db_xref="GOA:Q1AZU0"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZU0"
FT                   /protein_id="ABG03088.1"
FT                   /translation="MEIYLDYNATTPLDERVLEAMLPYLRERFGNPASAAHPFGWEAQA
FT                   ATELAREELAGAIGASPEEILFTSGATESDNWALKGLLRPGDHLVTAATEHEAVLEAAR
FT                   SLSRAGVRVTVLPVDGRGVVRPEALREALSPETRLVSVMLANNETGTLNPVRELAEVAH
FT                   ERGVPLHTDAAQALGKVPVDVGRLGVDLMSLSAHKCYGPKGVGALYVRRRPHPGVRRVR
FT                   PLPLLDGGGQERGLRSGTLNVPGIVGFGRAAALAAEALPEEARRISSLREALFEGLRAG
FT                   VPGLRLNGHPDLRLPNTLNVSFPGVEVGELLGAVPEVAASAGSACASLRAGPSHVLEAM
FT                   GAVREDWAAVRFSLGRFTTREEVERAAELVVRAWRGLAVSGAPNP"
     MEIYLDYNAT TPLDERVLEA MLPYLRERFG NPASAAHPFG WEAQAATELA REELAGAIGA        60
     SPEEILFTSG ATESDNWALK GLLRPGDHLV TAATEHEAVL EAARSLSRAG VRVTVLPVDG       120
     RGVVRPEALR EALSPETRLV SVMLANNETG TLNPVRELAE VAHERGVPLH TDAAQALGKV       180
     PVDVGRLGVD LMSLSAHKCY GPKGVGALYV RRRPHPGVRR VRPLPLLDGG GQERGLRSGT       240
     LNVPGIVGFG RAAALAAEAL PEEARRISSL REALFEGLRA GVPGLRLNGH PDLRLPNTLN       300
     VSFPGVEVGE LLGAVPEVAA SAGSACASLR AGPSHVLEAM GAVREDWAAV RFSLGRFTTR       360
     EEVERAAELV VRAWRGLAVS GAPNP                                             385
//

If you have problems or comments...

PBIL Back to PBIL home page