(data stored in ACNUC7421 zone)

EMBL: CP000386.PE113

CP000386.PE113       Location/Qualifiers
FT   CDS             120789..121931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0115"
FT                   /product="VWA containing CoxE-like protein"
FT                   /note="PFAM: VWA containing CoxE-like; SMART: von
FT                   Willebrand factor, type A; KEGG: mlo:mlr0089 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03094"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR008912"
FT                   /db_xref="InterPro:IPR011195"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZT4"
FT                   /protein_id="ABG03094.1"
FT                   /translation="MVEEEPAPRMLEAAVAFGRVLRGAGLAVGTDRLVGFARALEELDA
FT                   GRREDVYWAGRITLTSRPEDIEVYDRAFEAFWERGEEAPPPPRGGAELRIPEPEDSVMP
FT                   AKESVEADERGEEAVGLRYSPVEVLRKKDFALYSPEEFAELQRMLSDLRLSGALRRTRR
FT                   LEPARRGRHDPRRTMRGAMRTGGETVRHRFRRAKDQPRRVVLLCDVSGSMSPYSRALLR
FT                   FLHAGVISGARLEAFSVGTRLTRITRELSTRDPDRALRQAAGAVRDLSGGTRLGDALKE
FT                   FVDRWGQRGMARGAVVVILSDGWDRGDVALLAEQMRRIRRLAYRVIWVNPLKASPGYRP
FT                   LAAGMAAALPYVDVFLSGHNFESLEELARAVAEAAGDGRR"
     MVEEEPAPRM LEAAVAFGRV LRGAGLAVGT DRLVGFARAL EELDAGRRED VYWAGRITLT        60
     SRPEDIEVYD RAFEAFWERG EEAPPPPRGG AELRIPEPED SVMPAKESVE ADERGEEAVG       120
     LRYSPVEVLR KKDFALYSPE EFAELQRMLS DLRLSGALRR TRRLEPARRG RHDPRRTMRG       180
     AMRTGGETVR HRFRRAKDQP RRVVLLCDVS GSMSPYSRAL LRFLHAGVIS GARLEAFSVG       240
     TRLTRITREL STRDPDRALR QAAGAVRDLS GGTRLGDALK EFVDRWGQRG MARGAVVVIL       300
     SDGWDRGDVA LLAEQMRRIR RLAYRVIWVN PLKASPGYRP LAAGMAAALP YVDVFLSGHN       360
     FESLEELARA VAEAAGDGRR                                                   380
//

If you have problems or comments...

PBIL Back to PBIL home page