(data stored in ACNUC7421 zone)

EMBL: CP000386.PE114

CP000386.PE114       Location/Qualifiers
FT   CDS             121996..122310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0116"
FT                   /product="predicted sulfurylase small subunit,
FT                   molybdopterin cytosine dinucleotide biosynthesis"
FT                   /note="PFAM: protein of unknown function DUF182; KEGG:
FT                   ade:Adeh_3104 protein of unknown function DUF182"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03095"
FT                   /db_xref="InterPro:IPR003777"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZT3"
FT                   /protein_id="ABG03095.1"
FT                   /translation="MNPVVERVARWREEDKRCALATVVKVERSGPLGPGTSMAVSEDGE
FT                   VVGSVSGGCVEPAVYEEAMSAIQTGEPRLLTYGISDEEAFGVGLTCGGVIHIFVERVDW
FT                   "
     MNPVVERVAR WREEDKRCAL ATVVKVERSG PLGPGTSMAV SEDGEVVGSV SGGCVEPAVY        60
     EEAMSAIQTG EPRLLTYGIS DEEAFGVGLT CGGVIHIFVE RVDW                        104
//

If you have problems or comments...

PBIL Back to PBIL home page