(data stored in ACNUC7421 zone)

EMBL: CP000386.PE116

CP000386.PE116       Location/Qualifiers
FT   CDS             123110..123733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0118"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritol
FT                   synthase"
FT                   /note="PFAM: 4-diphosphocytidyl-2C-methyl-D-erythritol
FT                   synthase; KEGG: sco:SCO6244 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03097"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZT1"
FT                   /protein_id="ABG03097.1"
FT                   /translation="MSGVFGVLLAAGEGSRFGGGKLLAPFRGRPLVEHALLALREAPLE
FT                   GAVAVVGEGDAEGVRRLCGEHGVRVVENPRWREGQSTSVLAGIGALGPEARAAVVLLGD
FT                   QPLVGAGAVDRLVRAFEEGAKIAAATYAGRVRNPVLFAREVWPLLEEELAGDEGARRVL
FT                   RRHPGLVRRVPCDGVGDPADVDTREDLRRLEERAARGERRLPAR"
     MSGVFGVLLA AGEGSRFGGG KLLAPFRGRP LVEHALLALR EAPLEGAVAV VGEGDAEGVR        60
     RLCGEHGVRV VENPRWREGQ STSVLAGIGA LGPEARAAVV LLGDQPLVGA GAVDRLVRAF       120
     EEGAKIAAAT YAGRVRNPVL FAREVWPLLE EELAGDEGAR RVLRRHPGLV RRVPCDGVGD       180
     PADVDTREDL RRLEERAARG ERRLPAR                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page