(data stored in ACNUC7421 zone)

EMBL: CP000386.PE119

CP000386.PE119       Location/Qualifiers
FT   CDS             complement(124829..125464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0121"
FT                   /product="protein of unknown function DUF305"
FT                   /note="PFAM: protein of unknown function DUF305; KEGG:
FT                   ana:all7633 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03100"
FT                   /db_xref="InterPro:IPR005183"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZS8"
FT                   /protein_id="ABG03100.1"
FT                   /translation="MKRAGTLATVVAALLLSACAGAGVQEEPQDGAMHGGGQGEEHAEQ
FT                   MGGGHGAMGGMLAADNYSDRRFIDLMVPHHQGAVHMARVALENAEHREIRRLARNIIRS
FT                   QRAEIEELRDIKRQRYGTSSVPMQMDREQTQMMGMMDPQELAGEEPFDRAFIDAMIPHH
FT                   RSAIEMARVAREQTENPRIRRLAEDIIREQQREIEQMQRWREEWYSEG"
     MKRAGTLATV VAALLLSACA GAGVQEEPQD GAMHGGGQGE EHAEQMGGGH GAMGGMLAAD        60
     NYSDRRFIDL MVPHHQGAVH MARVALENAE HREIRRLARN IIRSQRAEIE ELRDIKRQRY       120
     GTSSVPMQMD REQTQMMGMM DPQELAGEEP FDRAFIDAMI PHHRSAIEMA RVAREQTENP       180
     RIRRLAEDII REQQREIEQM QRWREEWYSE G                                      211
//

If you have problems or comments...

PBIL Back to PBIL home page