(data stored in ACNUC7421 zone)

EMBL: CP000386.PE12

CP000386.PE12        Location/Qualifiers
FT   CDS             14396..15214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0012"
FT                   /product="succinate dehydrogenase subunit B"
FT                   /EC_number="1.3.5.1"
FT                   /note="TIGRFAM: succinate dehydrogenase and fumarate
FT                   reductase iron-sulfur protein; PFAM: ferredoxin; KEGG:
FT                   mbo:Mb0253c probable succinate dehydrogenase [iron-sulfur
FT                   subunit] (succinic dehydrogenase)"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABG02993"
FT                   /db_xref="GOA:Q1B035"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:Q1B035"
FT                   /protein_id="ABG02993.1"
FT                   /translation="MSDGNVTSRAHAPVGEEGLGGTGRTAKLKIFRGDASGGEEVEYEI
FT                   PLVEGMVILDAVLYIQAHQANDLAVRWNCKAAHCGSCSAEINGIPRLMCKTRVEEFEGR
FT                   EIHVGPMRAFPVIKDLVSDVSWNYEVSSKITPFTTSQKAPFTMYEEDVERLYEPKKCIE
FT                   CFMCQDVCHVLRTHHKHPEFAGPRFFVRNQWLEMHPMDEADRLGDLKEKNGLGYCNITK
FT                   CCTEVCPVGIKITDNSIIPLKERVADEYYDPARWLMRKIQGRRNGGRNGS"
     MSDGNVTSRA HAPVGEEGLG GTGRTAKLKI FRGDASGGEE VEYEIPLVEG MVILDAVLYI        60
     QAHQANDLAV RWNCKAAHCG SCSAEINGIP RLMCKTRVEE FEGREIHVGP MRAFPVIKDL       120
     VSDVSWNYEV SSKITPFTTS QKAPFTMYEE DVERLYEPKK CIECFMCQDV CHVLRTHHKH       180
     PEFAGPRFFV RNQWLEMHPM DEADRLGDLK EKNGLGYCNI TKCCTEVCPV GIKITDNSII       240
     PLKERVADEY YDPARWLMRK IQGRRNGGRN GS                                     272
//

If you have problems or comments...

PBIL Back to PBIL home page