(data stored in ACNUC7421 zone)

EMBL: CP000386.PE121

CP000386.PE121       Location/Qualifiers
FT   CDS             complement(126573..127988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0123"
FT                   /product="NADH dehydrogenase (quinone)"
FT                   /EC_number="1.6.99.5"
FT                   /note="PFAM: NADH/Ubiquinone/plastoquinone (complex I);
FT                   KEGG: cte:CT0776 NADH dehydrogenase I subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03102"
FT                   /db_xref="GOA:Q1AZS6"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR010096"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZS6"
FT                   /protein_id="ABG03102.1"
FT                   /translation="MISLLQGMQGMGGGPEMRMARDLALIAPEIAVLLTAVGALVFEML
FT                   RLPKVALPFTVVGLLAATALALPLLGTETTAFMDTFRVGPLGVWAKLALLPATALCALL
FT                   ARAEVRGTDREGTVYALLSFTALGALALAGAGDVMFLVLGVLLSSLGSFALVAYPRDER
FT                   STEAAMKYFVFGSVTGAVMIFGLTHWFGATSSTLLSELGRLEGAPLAAAFGLVAVAAGL
FT                   GYKAAIAPFHFWAPDAYDGAPVSVAAFLSVVPKVGALFGLAQVARDLPAGTGWPLVLAA
FT                   LAALSMTYGNLAALAQENVVRLLAYSSIAQSGYFLLGVVAVGQSDLAVPALVVFAAAYA
FT                   AMNLGAFAVVVRTGRRLGDLAGLGYESPWTGAAMVVFLISLVGIPPLAGFFGKLLLFGA
FT                   AIDAGFVWLAVVGILNSVLSLGVYLRVVVPMYRRQKLVAARPAPVARGVQAAALALTLG
FT                   IGLLAQIFFGGGG"
     MISLLQGMQG MGGGPEMRMA RDLALIAPEI AVLLTAVGAL VFEMLRLPKV ALPFTVVGLL        60
     AATALALPLL GTETTAFMDT FRVGPLGVWA KLALLPATAL CALLARAEVR GTDREGTVYA       120
     LLSFTALGAL ALAGAGDVMF LVLGVLLSSL GSFALVAYPR DERSTEAAMK YFVFGSVTGA       180
     VMIFGLTHWF GATSSTLLSE LGRLEGAPLA AAFGLVAVAA GLGYKAAIAP FHFWAPDAYD       240
     GAPVSVAAFL SVVPKVGALF GLAQVARDLP AGTGWPLVLA ALAALSMTYG NLAALAQENV       300
     VRLLAYSSIA QSGYFLLGVV AVGQSDLAVP ALVVFAAAYA AMNLGAFAVV VRTGRRLGDL       360
     AGLGYESPWT GAAMVVFLIS LVGIPPLAGF FGKLLLFGAA IDAGFVWLAV VGILNSVLSL       420
     GVYLRVVVPM YRRQKLVAAR PAPVARGVQA AALALTLGIG LLAQIFFGGG G                471
//

If you have problems or comments...

PBIL Back to PBIL home page