(data stored in ACNUC7421 zone)

EMBL: CP000386.PE122

CP000386.PE122       Location/Qualifiers
FT   CDS             complement(127985..129448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0124"
FT                   /product="proton-translocating NADH-quinone oxidoreductase,
FT                   chain M"
FT                   /EC_number="1.6.99.5"
FT                   /note="KEGG: gsu:GSU3430 NADH dehydrogenase I, M subunit;
FT                   TIGRFAM: proton-translocating NADH-quinone oxidoreductase,
FT                   chain M; PFAM: NADH/Ubiquinone/plastoquinone (complex I)"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03103"
FT                   /db_xref="GOA:Q1AZS5"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="InterPro:IPR010227"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZS5"
FT                   /protein_id="ABG03103.1"
FT                   /translation="MIPIVSATLFLPLLGAALLAAWRGAPPRAAHALGIAFSGLALLGA
FT                   AWMWARGASGEGFSQVEEVAWIPSLGVAYRVGVDGISLPLVLMTAVLFFVSLVFSAGIR
FT                   ERARSYVALFLLLETASLGVFVALDAVLFYVFFEVTLVGMYFIISGWGYEDRQRAALMF
FT                   FLYTLLGSLPLLLAILGLYLGSEPNTFDMRELIANPPLTGLAATLALLAMLVTFFVKTP
FT                   VFPLHTWLPAAHVEAPTAGSVILAGVLLKLGTYGLVRFALQMTPDAFRDLAPYVAALAA
FT                   FSALYGAFVALGQSDLKRLVAYTSVNHMGYVVLGVAVAAAATGARAVALDGAVLQMVSH
FT                   GVVTGALFLLVGMLQDRAHTREMGAFGGLLGVVPGLGWAFVLAAFASLGLPGLAHFPAE
FT                   FQIFLGTLRVYPPAVVAVLGIAVTAGLYLRAIQVAFLGEPRGERRKLRDLGARETLAVV
FT                   PLLALTVLIGVVPSLALGVIHATTEALLP"
     MIPIVSATLF LPLLGAALLA AWRGAPPRAA HALGIAFSGL ALLGAAWMWA RGASGEGFSQ        60
     VEEVAWIPSL GVAYRVGVDG ISLPLVLMTA VLFFVSLVFS AGIRERARSY VALFLLLETA       120
     SLGVFVALDA VLFYVFFEVT LVGMYFIISG WGYEDRQRAA LMFFLYTLLG SLPLLLAILG       180
     LYLGSEPNTF DMRELIANPP LTGLAATLAL LAMLVTFFVK TPVFPLHTWL PAAHVEAPTA       240
     GSVILAGVLL KLGTYGLVRF ALQMTPDAFR DLAPYVAALA AFSALYGAFV ALGQSDLKRL       300
     VAYTSVNHMG YVVLGVAVAA AATGARAVAL DGAVLQMVSH GVVTGALFLL VGMLQDRAHT       360
     REMGAFGGLL GVVPGLGWAF VLAAFASLGL PGLAHFPAEF QIFLGTLRVY PPAVVAVLGI       420
     AVTAGLYLRA IQVAFLGEPR GERRKLRDLG ARETLAVVPL LALTVLIGVV PSLALGVIHA       480
     TTEALLP                                                                 487
//

If you have problems or comments...

PBIL Back to PBIL home page