(data stored in ACNUC7421 zone)

EMBL: CP000386.PE129

CP000386.PE129       Location/Qualifiers
FT   CDS             complement(134964..135176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0131"
FT                   /product="Heavy metal transport/detoxification protein"
FT                   /note="PFAM: Heavy metal transport/detoxification protein;
FT                   KEGG: gka:GK0903 mercuric ion-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03110"
FT                   /db_xref="GOA:Q1AZR8"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZR8"
FT                   /protein_id="ABG03110.1"
FT                   /translation="MEKRITLRVPDMSCGHCKAAIEGELGRLPVAEASADPQTKAVEVV
FT                   YDEERVDERQIRAAIEEAGYTVEAG"
     MEKRITLRVP DMSCGHCKAA IEGELGRLPV AEASADPQTK AVEVVYDEER VDERQIRAAI        60
     EEAGYTVEAG                                                               70
//

If you have problems or comments...

PBIL Back to PBIL home page