(data stored in ACNUC7421 zone)

EMBL: CP000386.PE138

CP000386.PE138       Location/Qualifiers
FT   CDS             145174..145704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0140"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mpa:MAP0794
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03119"
FT                   /db_xref="GOA:Q1AZQ9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZQ9"
FT                   /protein_id="ABG03119.1"
FT                   /translation="MARRLSASRRAQILEAALGMFSERGYEGTPLSAIAEEVGLSKPGI
FT                   VHHFPHKDDILEALFGPVFGEVEALLEGRPGREELLEGYLEIILRNRRLTVLLATDLAI
FT                   LNRPRIGERVCALNLRLRVALAGPGSTLEEEMRAECALGALRSPVVFFPEADPGLVRRV
FT                   ALEAARRVLGAGR"
     MARRLSASRR AQILEAALGM FSERGYEGTP LSAIAEEVGL SKPGIVHHFP HKDDILEALF        60
     GPVFGEVEAL LEGRPGREEL LEGYLEIILR NRRLTVLLAT DLAILNRPRI GERVCALNLR       120
     LRVALAGPGS TLEEEMRAEC ALGALRSPVV FFPEADPGLV RRVALEAARR VLGAGR           176
//

If you have problems or comments...

PBIL Back to PBIL home page