(data stored in ACNUC7421 zone)

EMBL: CP000386.PE145

CP000386.PE145       Location/Qualifiers
FT   CDS             complement(152969..154141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0147"
FT                   /product="Alcohol dehydrogenase GroES-like protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding Alcohol
FT                   dehydrogenase GroES-like; KEGG: sco:SCO4055 alcohol
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03126"
FT                   /db_xref="GOA:Q1AZQ2"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR027399"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZQ2"
FT                   /protein_id="ABG03126.1"
FT                   /translation="MRAVVYKGPFEVAVENVEDPKIQDPNDVVVRITSTCICGSDLHMY
FT                   EGRTAAEPGIVFGHENLGIVEEVGPGVVSLRQGDRVVMPFNVACGFCKNCQRGYTGFCL
FT                   TVNQGFAGGAYGYVAMGPYTGGQAEYLRVPFADFNCLKLPEGDEHEADFALLADIFPTG
FT                   YHGTELADVQPGETVAVFGAGPVGLMAAYSAMIRGAERVFVVDRVKERLDKAEEIGCIP
FT                   VNFDEVDPVEYIKEQTPGNRLSTLSVDNDANRGADKGIDAVGYQAHVRGGEREEPAIVL
FT                   NTLIECVRPTGALGVPGLYVPSDPGAPDDASKKGQLLVSIGRMFEKGLRMGTGQCNVKR
FT                   YNAYLRDLIIAGRARPSFVVSHEVPLDQAPEAYEKFDKRIEGYTKVILKP"
     MRAVVYKGPF EVAVENVEDP KIQDPNDVVV RITSTCICGS DLHMYEGRTA AEPGIVFGHE        60
     NLGIVEEVGP GVVSLRQGDR VVMPFNVACG FCKNCQRGYT GFCLTVNQGF AGGAYGYVAM       120
     GPYTGGQAEY LRVPFADFNC LKLPEGDEHE ADFALLADIF PTGYHGTELA DVQPGETVAV       180
     FGAGPVGLMA AYSAMIRGAE RVFVVDRVKE RLDKAEEIGC IPVNFDEVDP VEYIKEQTPG       240
     NRLSTLSVDN DANRGADKGI DAVGYQAHVR GGEREEPAIV LNTLIECVRP TGALGVPGLY       300
     VPSDPGAPDD ASKKGQLLVS IGRMFEKGLR MGTGQCNVKR YNAYLRDLII AGRARPSFVV       360
     SHEVPLDQAP EAYEKFDKRI EGYTKVILKP                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page