(data stored in ACNUC7421 zone)

EMBL: CP000386.PE147

CP000386.PE147       Location/Qualifiers
FT   CDS             complement(154840..156525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0149"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gvi:glr3825 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03128"
FT                   /db_xref="InterPro:IPR018946"
FT                   /db_xref="InterPro:IPR038607"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZQ0"
FT                   /protein_id="ABG03128.1"
FT                   /translation="MDAPELVLGPLLRFVGPREATVWVETSRPAEVEVRPAGGPPPSRE
FT                   RTFSVAGHHYALVTLRGLEPGSSCGYEVLLDGRRRWPPSGGPFPPPLIRTPDPSSGRLR
FT                   LAFGSCRVSVPHEPPYTLRRGSLKRGGVLRRGFYERDALYALALRMRGQPPGRWPDALL
FT                   MLGDQIYADEVSPQAKEFIRSRRDTSKPPGEQVADFEEYTRLYLEAWRTPAIRWLLSTV
FT                   PSAMIFDDHDVHDDWNTSEAWVRKMRSKPWWEERIVGAFMSYWVYQHLGNLSPAELEED
FT                   PLFAKVRGSRDATQTLRGFARAADRDVAANRWSFRRDFGRVRLVVADSRAGRVLSEGRR
FT                   AMLDEAEWAWIEEQVLSGGFDHLLFATSLPFVLSPGLHHLEAASEAVCGGAWGRAAARA
FT                   GEAVRQALDLEHWSAFGRSFAALSGLLRRAASGEGAPASIAVLSGDVHHGYLAALDLGP
FT                   GARSPAYQAVGSPIRNPLGLPERLALRAAWTRAGAALGRGIARLAGVGEPPVGWRLLHQ
FT                   SPWFDNHISTLSFEGRRATLLVEKTTPEDGKPPKLLPILERRLA"
     MDAPELVLGP LLRFVGPREA TVWVETSRPA EVEVRPAGGP PPSRERTFSV AGHHYALVTL        60
     RGLEPGSSCG YEVLLDGRRR WPPSGGPFPP PLIRTPDPSS GRLRLAFGSC RVSVPHEPPY       120
     TLRRGSLKRG GVLRRGFYER DALYALALRM RGQPPGRWPD ALLMLGDQIY ADEVSPQAKE       180
     FIRSRRDTSK PPGEQVADFE EYTRLYLEAW RTPAIRWLLS TVPSAMIFDD HDVHDDWNTS       240
     EAWVRKMRSK PWWEERIVGA FMSYWVYQHL GNLSPAELEE DPLFAKVRGS RDATQTLRGF       300
     ARAADRDVAA NRWSFRRDFG RVRLVVADSR AGRVLSEGRR AMLDEAEWAW IEEQVLSGGF       360
     DHLLFATSLP FVLSPGLHHL EAASEAVCGG AWGRAAARAG EAVRQALDLE HWSAFGRSFA       420
     ALSGLLRRAA SGEGAPASIA VLSGDVHHGY LAALDLGPGA RSPAYQAVGS PIRNPLGLPE       480
     RLALRAAWTR AGAALGRGIA RLAGVGEPPV GWRLLHQSPW FDNHISTLSF EGRRATLLVE       540
     KTTPEDGKPP KLLPILERRL A                                                 561
//

If you have problems or comments...

PBIL Back to PBIL home page