(data stored in ACNUC7421 zone)

EMBL: CP000386.PE151

CP000386.PE151       Location/Qualifiers
FT   CDS             complement(159997..160665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0153"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tte:TTE0745 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03132"
FT                   /db_xref="InterPro:IPR018708"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZP6"
FT                   /protein_id="ABG03132.1"
FT                   /translation="MGEIRRVYTRCPLCGQIFRAAHAGSYITVGRDTDLCPRFPGRRFD
FT                   AARLIRSEITMCPRCNFASAEDFRELDLSFDERYDLEERLRGDGLLRIFRANQPPWLAF
FT                   HAAEICGQERRLPARELGDLCLRASWVCRKAGERAFESTFQLRAVRYFMRALDNEELEG
FT                   RRLPVTTYLVGELNRRLGHHREALNWYVNAERTMQAVGRMAWLDRLISRQSKLAREQAA
FT                   "
     MGEIRRVYTR CPLCGQIFRA AHAGSYITVG RDTDLCPRFP GRRFDAARLI RSEITMCPRC        60
     NFASAEDFRE LDLSFDERYD LEERLRGDGL LRIFRANQPP WLAFHAAEIC GQERRLPARE       120
     LGDLCLRASW VCRKAGERAF ESTFQLRAVR YFMRALDNEE LEGRRLPVTT YLVGELNRRL       180
     GHHREALNWY VNAERTMQAV GRMAWLDRLI SRQSKLAREQ AA                          222
//

If you have problems or comments...

PBIL Back to PBIL home page