(data stored in ACNUC7421 zone)

EMBL: CP000386.PE153

CP000386.PE153       Location/Qualifiers
FT   CDS             162147..163703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0156"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: ATPase; KEGG:
FT                   gka:GK1284 ABC transporter (ATP-binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03134"
FT                   /db_xref="GOA:Q1AZP4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZP4"
FT                   /protein_id="ABG03134.1"
FT                   /translation="MAEREPTGGQAGTAGEAPVVLEMRGITKTFGAVRANDGISISLRR
FT                   GEVLGILGENGAGKSTLMKILYGLYSPDAGEIFLDGERAEIKDPKDAVERGIGMVHQHF
FT                   TLIPPLTVAENIVLGAEPRRGLAVDLQRAVRETGELCERYGLRVDPRARVADLSVGEQQ
FT                   RVEILKALYREARILVLDEPTAVLTPQETEDLFSTLKELVASGLSIILITHKLGELLGV
FT                   SDRITIIRDGRVVDTVPAARTDERELARLMVGREVLLRVEKEEAEPGGVRLQAEGLVVR
FT                   SSRGTVAVRGVSLEVRGGEILGIAGVDGNGQTELAEALAGTRPAEGGAVRLDGEDVTRL
FT                   GAKARKRRGLAYVPEDRMAKGLVPDFALYENHALKTYDEPPYASRWGWLRPAAMRRRAA
FT                   EALRAFDVRPPDPDLPARSLSGGNQQKAILARELSGDPGVIIAYQPTRGVDVGAIEFIH
FT                   GQLLRQRGEGKAILLISLELEEVRSLSDGILVLCDGRIVGEVGPEATDEELGLLMAGRA
FT                   G"
     MAEREPTGGQ AGTAGEAPVV LEMRGITKTF GAVRANDGIS ISLRRGEVLG ILGENGAGKS        60
     TLMKILYGLY SPDAGEIFLD GERAEIKDPK DAVERGIGMV HQHFTLIPPL TVAENIVLGA       120
     EPRRGLAVDL QRAVRETGEL CERYGLRVDP RARVADLSVG EQQRVEILKA LYREARILVL       180
     DEPTAVLTPQ ETEDLFSTLK ELVASGLSII LITHKLGELL GVSDRITIIR DGRVVDTVPA       240
     ARTDERELAR LMVGREVLLR VEKEEAEPGG VRLQAEGLVV RSSRGTVAVR GVSLEVRGGE       300
     ILGIAGVDGN GQTELAEALA GTRPAEGGAV RLDGEDVTRL GAKARKRRGL AYVPEDRMAK       360
     GLVPDFALYE NHALKTYDEP PYASRWGWLR PAAMRRRAAE ALRAFDVRPP DPDLPARSLS       420
     GGNQQKAILA RELSGDPGVI IAYQPTRGVD VGAIEFIHGQ LLRQRGEGKA ILLISLELEE       480
     VRSLSDGILV LCDGRIVGEV GPEATDEELG LLMAGRAG                               518
//

If you have problems or comments...

PBIL Back to PBIL home page