(data stored in ACNUC7421 zone)

EMBL: CP000386.PE159

CP000386.PE159       Location/Qualifiers
FT   CDS             complement(168717..168950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0162"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix motif; KEGG: det:DET0884
FT                   transcriptional repressor LexA, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03140"
FT                   /db_xref="GOA:Q1AZN8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZN8"
FT                   /protein_id="ABG03140.1"
FT                   /translation="MELPHLRDLRLRAVMSQEELARRSGVARDTISKLETGKRRAYPST
FT                   VRKLAEGLEVEPQALVGEALPAEREGQGEAGF"
     MELPHLRDLR LRAVMSQEEL ARRSGVARDT ISKLETGKRR AYPSTVRKLA EGLEVEPQAL        60
     VGEALPAERE GQGEAGF                                                       77
//

If you have problems or comments...

PBIL Back to PBIL home page