(data stored in ACNUC7421 zone)

EMBL: CP000386.PE160

CP000386.PE160       Location/Qualifiers
FT   CDS             169065..169478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0163"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03141"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZN7"
FT                   /protein_id="ABG03141.1"
FT                   /translation="MILTHEYIRHRSGYAFGAGCCWIRIYRGGPGDAPVVICEEVPGSG
FT                   ASVSEMSSQLAAEVIRDHFAGGLPDLPRPLLWIERRPARRGRRERYFLLTFPSYTPKPE
FT                   APGFVRRVTLGPPEREPLAAEEVAALTGGAPVP"
     MILTHEYIRH RSGYAFGAGC CWIRIYRGGP GDAPVVICEE VPGSGASVSE MSSQLAAEVI        60
     RDHFAGGLPD LPRPLLWIER RPARRGRRER YFLLTFPSYT PKPEAPGFVR RVTLGPPERE       120
     PLAAEEVAAL TGGAPVP                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page