(data stored in ACNUC7421 zone)

EMBL: CP000386.PE162

CP000386.PE162       Location/Qualifiers
FT   CDS             complement(169977..170399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0165"
FT                   /product="SUF system FeS assembly protein"
FT                   /note="TIGRFAM: SUF system FeS assembly protein; PFAM:
FT                   nitrogen-fixing NifU-like-like; KEGG: lmf:LMOf2365_2383
FT                   NifU family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03143"
FT                   /db_xref="GOA:Q1AZN5"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZN5"
FT                   /protein_id="ABG03143.1"
FT                   /translation="MMRDLYGQVIMDHYRRPRNRGELEDADLTRHLLNPLCGDEVTVYA
FT                   RFEGDRVAEASFTGRGCSISQASASMMTERLRGKSREEAEAEISRFKRMMTGEEEFPEG
FT                   DDLAALKGVIQYPSRIRCATLAWEAFQQGLEEKGAP"
     MMRDLYGQVI MDHYRRPRNR GELEDADLTR HLLNPLCGDE VTVYARFEGD RVAEASFTGR        60
     GCSISQASAS MMTERLRGKS REEAEAEISR FKRMMTGEEE FPEGDDLAAL KGVIQYPSRI       120
     RCATLAWEAF QQGLEEKGAP                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page