(data stored in ACNUC7421 zone)

EMBL: CP000386.PE165

CP000386.PE165       Location/Qualifiers
FT   CDS             complement(172002..173363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0168"
FT                   /product="Iron-regulated ABC transporter permease protein
FT                   SufD"
FT                   /note="TIGRFAM: FeS assembly protein SufD; PFAM: SufBD;
FT                   KEGG: dra:DR2101 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03146"
FT                   /db_xref="GOA:Q1AZN2"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR011542"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZN2"
FT                   /protein_id="ABG03146.1"
FT                   /translation="MSTNGVPEVLRRKGIGIEAVKALAAFKDEPGWLREKRLAAWRTFE
FT                   EIPMPTMRDEAWRYTDVSDVRFEEYVPYAPSPDVEREGDLPDAVQRLIKEGEENSALLV
FT                   QHNSETTYARTDEALRARGVIFTDLHTALREHGELVRERLFRLVPEGYDKFAALSAAAF
FT                   SGGSFLYVPRGVEVEVPIQSYRWLDVAGSIMPRTLVIVEEGASVTYIDEYASEDGEEPA
FT                   LSNGAVELFVGQGAHLQYVSLQNWARNVVHFNTIRSQAEKDATINSLVVSFGAQLSRTN
FT                   VEAGLTAPGSDSEMLGLYFADEDQLIDHHTLQDHIAPQAHSDLLYKGALRDESLTVFSG
FT                   LIRVEPGAQKTDAYQTNRNLILGTDEAMAVSLPNLEIMADDVKCSHGATTGQVDDLELF
FT                   YLMSRGIPRIEAEKLVVFGFFGEVTSRIPLRGLKEKLDRAIEEKIGLGFEERVA"
     MSTNGVPEVL RRKGIGIEAV KALAAFKDEP GWLREKRLAA WRTFEEIPMP TMRDEAWRYT        60
     DVSDVRFEEY VPYAPSPDVE REGDLPDAVQ RLIKEGEENS ALLVQHNSET TYARTDEALR       120
     ARGVIFTDLH TALREHGELV RERLFRLVPE GYDKFAALSA AAFSGGSFLY VPRGVEVEVP       180
     IQSYRWLDVA GSIMPRTLVI VEEGASVTYI DEYASEDGEE PALSNGAVEL FVGQGAHLQY       240
     VSLQNWARNV VHFNTIRSQA EKDATINSLV VSFGAQLSRT NVEAGLTAPG SDSEMLGLYF       300
     ADEDQLIDHH TLQDHIAPQA HSDLLYKGAL RDESLTVFSG LIRVEPGAQK TDAYQTNRNL       360
     ILGTDEAMAV SLPNLEIMAD DVKCSHGATT GQVDDLELFY LMSRGIPRIE AEKLVVFGFF       420
     GEVTSRIPLR GLKEKLDRAI EEKIGLGFEE RVA                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page