(data stored in ACNUC7421 zone)

EMBL: CP000386.PE166

CP000386.PE166       Location/Qualifiers
FT   CDS             complement(173360..173815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0169"
FT                   /product="UspA"
FT                   /note="PFAM: UspA; KEGG: tbd:Tbd_2614 universal stress
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03147"
FT                   /db_xref="GOA:Q1AZN1"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZN1"
FT                   /protein_id="ABG03147.1"
FT                   /translation="MFPTKILLATDGSEHARRAARAAVELAQKTGSELHVVHVGPAVTS
FT                   IFAYTELDPARVEEEARKALDEEVRSIEESGGAVAEGHVLLGNPAESIVSLAEEMGAGL
FT                   IVVGSRGLGGLRRALMGSVSESVVRHAHCPVLVVRGDAEDAEGEGDR"
     MFPTKILLAT DGSEHARRAA RAAVELAQKT GSELHVVHVG PAVTSIFAYT ELDPARVEEE        60
     ARKALDEEVR SIEESGGAVA EGHVLLGNPA ESIVSLAEEM GAGLIVVGSR GLGGLRRALM       120
     GSVSESVVRH AHCPVLVVRG DAEDAEGEGD R                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page