(data stored in ACNUC7421 zone)

EMBL: CP000386.PE167

CP000386.PE167       Location/Qualifiers
FT   CDS             complement(173919..175331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0170"
FT                   /product="Iron-regulated ABC transporter membrane component
FT                   SufB"
FT                   /note="TIGRFAM: FeS assembly protein SufB; PFAM: SufBD;
FT                   KEGG: dra:DR2106 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03148"
FT                   /db_xref="GOA:Q1AZN0"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR010231"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZN0"
FT                   /protein_id="ABG03148.1"
FT                   /translation="MPADKTIQELGLEEYKYGFKDPEEYFFKTPRKGLDEEIVTMISLH
FT                   KKEPEWMLEFRLNALKAFQEKPVPTWGADLSELDFDDIYYYIKPVENQGRSWDEVPESI
FT                   KKTFDRLGIPQAEREILAGVGAQYESEVVYHNLKEEWEKQGVVFLDMDGGLREHEDLVR
FT                   EYFGTVIPPDDNKFAALNSAVWSGGSFVYVPPGVHVDIPLQAYFRINAENMGQFERTLI
FT                   IADEGSYVHYIEGCTAPTYTTNSLHSAVVELIAKPNARIRYSTIQNWSHNTYNLVTKRG
FT                   VAYENATIEWVDGNLGSKVTMKYPAVYLMGEGARGEILSVAYAGDGQHQDAGGKVVHVA
FT                   PNTSSLITSKSISKGTGRATYRGLLKVHEGAVNSKSRVECDALLLDEKARTDTYPYIEI
FT                   EEKKVNTEHEATVSKVGEEQLFYLMSRGLSEEEAMAMVVNGFIEPIAKELPLEYAIELN
FT                   RLIQLEMEGSVG"
     MPADKTIQEL GLEEYKYGFK DPEEYFFKTP RKGLDEEIVT MISLHKKEPE WMLEFRLNAL        60
     KAFQEKPVPT WGADLSELDF DDIYYYIKPV ENQGRSWDEV PESIKKTFDR LGIPQAEREI       120
     LAGVGAQYES EVVYHNLKEE WEKQGVVFLD MDGGLREHED LVREYFGTVI PPDDNKFAAL       180
     NSAVWSGGSF VYVPPGVHVD IPLQAYFRIN AENMGQFERT LIIADEGSYV HYIEGCTAPT       240
     YTTNSLHSAV VELIAKPNAR IRYSTIQNWS HNTYNLVTKR GVAYENATIE WVDGNLGSKV       300
     TMKYPAVYLM GEGARGEILS VAYAGDGQHQ DAGGKVVHVA PNTSSLITSK SISKGTGRAT       360
     YRGLLKVHEG AVNSKSRVEC DALLLDEKAR TDTYPYIEIE EKKVNTEHEA TVSKVGEEQL       420
     FYLMSRGLSE EEAMAMVVNG FIEPIAKELP LEYAIELNRL IQLEMEGSVG                  470
//

If you have problems or comments...

PBIL Back to PBIL home page