(data stored in ACNUC7421 zone)

EMBL: CP000386.PE172

CP000386.PE172       Location/Qualifiers
FT   CDS             178962..179165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0175"
FT                   /product="cold-shock DNA-binding protein family"
FT                   /note="PFAM: Cold-shock protein, DNA-binding; SMART: Cold
FT                   shock protein; KEGG: neu:NE1731 cold-shock DNA-binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03153"
FT                   /db_xref="GOA:Q1AZM5"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZM5"
FT                   /protein_id="ABG03153.1"
FT                   /translation="MAQGTVKWFSDEKGYGFISPDDGSEDLFVHYTGIEGTGFKTLEEG
FT                   ARVSYETTRGRKGMQAVKVSRI"
     MAQGTVKWFS DEKGYGFISP DDGSEDLFVH YTGIEGTGFK TLEEGARVSY ETTRGRKGMQ        60
     AVKVSRI                                                                  67
//

If you have problems or comments...

PBIL Back to PBIL home page