(data stored in ACNUC7421 zone)

EMBL: CP000386.PE173

CP000386.PE173       Location/Qualifiers
FT   CDS             complement(179239..180393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0176"
FT                   /product="protein of unknown function DUF111"
FT                   /note="PFAM: protein of unknown function DUF111; KEGG:
FT                   gsu:GSU0141 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03154"
FT                   /db_xref="GOA:Q1AZM4"
FT                   /db_xref="InterPro:IPR002822"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZM4"
FT                   /protein_id="ABG03154.1"
FT                   /translation="MGGAAGDMILASLISAGAPAGEVEESVRGLGLPVRLELRRVEISG
FT                   IAALGLRVDAPEEHAHRTFRDIRRLIEGSGLPERAAGRALAAFGLLAAAEGRVHGVPPE
FT                   EVAFHEVGAADSIADIVGACAALELLGAETVSCGPLPMGSGVVEAAHGPLPVPGPATLE
FT                   VLRGCRVRWPEEEREMTTPTGAALLRALTGGEFSDAAPPMVLGAAGYGAGTARLRGAPN
FT                   LLRAVVGRLEGPVGGLEVLEANIDDAPGEVLGAAVERLLEAGAPDAWLEPVVMKRGRGA
FT                   YKLCALARRQDRERLARLMMRETGSLGVRHHGVGRTVAERRLVEVELPYGRCRVKVGSL
FT                   DGEDFAVAPEHADAARLARESGRPLPRVYDDARRAASELLRQSP"
     MGGAAGDMIL ASLISAGAPA GEVEESVRGL GLPVRLELRR VEISGIAALG LRVDAPEEHA        60
     HRTFRDIRRL IEGSGLPERA AGRALAAFGL LAAAEGRVHG VPPEEVAFHE VGAADSIADI       120
     VGACAALELL GAETVSCGPL PMGSGVVEAA HGPLPVPGPA TLEVLRGCRV RWPEEEREMT       180
     TPTGAALLRA LTGGEFSDAA PPMVLGAAGY GAGTARLRGA PNLLRAVVGR LEGPVGGLEV       240
     LEANIDDAPG EVLGAAVERL LEAGAPDAWL EPVVMKRGRG AYKLCALARR QDRERLARLM       300
     MRETGSLGVR HHGVGRTVAE RRLVEVELPY GRCRVKVGSL DGEDFAVAPE HADAARLARE       360
     SGRPLPRVYD DARRAASELL RQSP                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page