(data stored in ACNUC7421 zone)

EMBL: CP000386.PE174

CP000386.PE174       Location/Qualifiers
FT   CDS             complement(180420..180770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0177"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03155"
FT                   /db_xref="InterPro:IPR022062"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZM3"
FT                   /protein_id="ABG03155.1"
FT                   /translation="MSEIPERIEREMFEIRSRMAPDVRDLRRHVEPRVVVQQTKEKAKA
FT                   RLKEALGRLGRSVAESARRQARLAREAGRKRNPSVFTDAVKSDPRPMILLAVALAAAAM
FT                   VVRRISGGGSGK"
     MSEIPERIER EMFEIRSRMA PDVRDLRRHV EPRVVVQQTK EKAKARLKEA LGRLGRSVAE        60
     SARRQARLAR EAGRKRNPSV FTDAVKSDPR PMILLAVALA AAAMVVRRIS GGGSGK           116
//

If you have problems or comments...

PBIL Back to PBIL home page