(data stored in ACNUC7421 zone)

EMBL: CP000386.PE175

CP000386.PE175       Location/Qualifiers
FT   CDS             complement(180767..181216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0178"
FT                   /product="protein of unknown function DUF1469"
FT                   /note="PFAM: protein of unknown function DUF1469; KEGG:
FT                   sma:SAV6345 putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03156"
FT                   /db_xref="GOA:Q1AZM2"
FT                   /db_xref="InterPro:IPR009937"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZM2"
FT                   /protein_id="ABG03156.1"
FT                   /translation="MTEQRERVAEFERRLEGGEELSDRSVKEIVEALRPQLQELARKQV
FT                   ELAKVELAPVGRQAGLAAGLLVAGAVFLHLFVVFLAVTGIYLLNEVGGLSLWLSALIVS
FT                   GILLVIGGVLAGTGAGRLRGLDPKPRRTISTFQQNVEWLKGQFRS"
     MTEQRERVAE FERRLEGGEE LSDRSVKEIV EALRPQLQEL ARKQVELAKV ELAPVGRQAG        60
     LAAGLLVAGA VFLHLFVVFL AVTGIYLLNE VGGLSLWLSA LIVSGILLVI GGVLAGTGAG       120
     RLRGLDPKPR RTISTFQQNV EWLKGQFRS                                         149
//

If you have problems or comments...

PBIL Back to PBIL home page