(data stored in ACNUC7421 zone)

EMBL: CP000386.PE176

CP000386.PE176       Location/Qualifiers
FT   CDS             181437..182180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0179"
FT                   /product="uncharacterized MobA-related protein-like
FT                   protein"
FT                   /note="KEGG: mta:Moth_2003 uncharacterized MobA-related
FT                   protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03157"
FT                   /db_xref="InterPro:IPR017587"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZM1"
FT                   /protein_id="ABG03157.1"
FT                   /translation="MKLYPALGISSGDVVAFVGAGGKSSAIIAVAGELVGDGMTAIAVP
FT                   TTKMQVGEAERVGRVVIAGEEGWLGRLKEAVTDSGAAAVGSAYISGGRIGGLGLDEVAP
FT                   LGRIADVVLVEADGARRKPLKGTAEHEPAIPRGTTLVVAVANIGALGRPATEEHIHRPE
FT                   VFSRLTGLSSGQSVTPRAFALALSGGSLARVPSGARSAVLLTGVSPGRSMSDAAVVTRE
FT                   LWRQGISRIVFTSLPSEEPVQVWVP"
     MKLYPALGIS SGDVVAFVGA GGKSSAIIAV AGELVGDGMT AIAVPTTKMQ VGEAERVGRV        60
     VIAGEEGWLG RLKEAVTDSG AAAVGSAYIS GGRIGGLGLD EVAPLGRIAD VVLVEADGAR       120
     RKPLKGTAEH EPAIPRGTTL VVAVANIGAL GRPATEEHIH RPEVFSRLTG LSSGQSVTPR       180
     AFALALSGGS LARVPSGARS AVLLTGVSPG RSMSDAAVVT RELWRQGISR IVFTSLPSEE       240
     PVQVWVP                                                                 247
//

If you have problems or comments...

PBIL Back to PBIL home page