(data stored in ACNUC7421 zone)

EMBL: CP000386.PE181

CP000386.PE181       Location/Qualifiers
FT   CDS             complement(185248..186081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0184"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: protein kinase; SMART: Tyrosine protein kinase
FT                   Serine/threonine protein kinase; KEGG: ade:Adeh_2796
FT                   serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03162"
FT                   /db_xref="GOA:Q1AZL6"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZL6"
FT                   /protein_id="ABG03162.1"
FT                   /translation="MSLRAEGPPPLPAGSEAAPGYRVISHLHRSNHYDVYDVFSEERAC
FT                   RCVAKVPIPREGNGRAVRRLLREGTLLRRLAHPHIVRAYDVIREPRPAVILETLTGETL
FT                   SYLIDTAPRRLPLREVACLGIHLCSAVHYLHRHGILHLDLKPSNIVSERGFAKILDLSI
FT                   ARPPGRARRGGGTLQYMAPEQVRGGGLLGPATDVWGIGAVLFEALTGEMPFNREVEGEE
FT                   DPETYEQLERRAEPVRSHRRVPASLARLVERCLEPDPAQRPAALELMRGLEPFAG"
     MSLRAEGPPP LPAGSEAAPG YRVISHLHRS NHYDVYDVFS EERACRCVAK VPIPREGNGR        60
     AVRRLLREGT LLRRLAHPHI VRAYDVIREP RPAVILETLT GETLSYLIDT APRRLPLREV       120
     ACLGIHLCSA VHYLHRHGIL HLDLKPSNIV SERGFAKILD LSIARPPGRA RRGGGTLQYM       180
     APEQVRGGGL LGPATDVWGI GAVLFEALTG EMPFNREVEG EEDPETYEQL ERRAEPVRSH       240
     RRVPASLARL VERCLEPDPA QRPAALELMR GLEPFAG                                277
//

If you have problems or comments...

PBIL Back to PBIL home page