(data stored in ACNUC7421 zone)

EMBL: CP000386.PE182

CP000386.PE182       Location/Qualifiers
FT   CDS             complement(186078..187913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0185"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter, transmembrane region ABC
FT                   transporter related; SMART: ATPase; KEGG: sma:SAV3872
FT                   putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03163"
FT                   /db_xref="GOA:Q1AZL5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZL5"
FT                   /protein_id="ABG03163.1"
FT                   /translation="MGKTWRKRLRLGLGWLAGDMREGGGPVAAAPAMPLREILRRFWPH
FT                   ARPYRRWLVPLLLLAALGPAVETATIWMYKVLVDGVLIPGEFGLLPWVVLAYLGLTLLD
FT                   GAISFLDGYLSEWVGGRFILRLRTGLFRHLQTLSLDFFDRRKLGDTVARISDDVEEIEE
FT                   LLLSGAVSAVTYAFQLLFFVGALFYLEWRLALVSLLVAPLFWLVARRFSRRIKRAAREE
FT                   RRKAGSIGAVAEESLSNAALVQAYNRQEHEVARFHRENEEGFAAQMVAARLSALFSPLV
FT                   NLIELLGALTVVSFGAYLLSRGALTVGGLLAFLVYLGMLYRPIRGFSRLANSFFSAAAA
FT                   AERVAELLQMRPAVRGGALEPGRLRGEVRFREVTFRYPGAAEPALRGVSFEARPGEVVA
FT                   LAGPSGAGKSTVVRLLLRFYDPEGGSISIDGYELRELSLRALRENVAVVLQEAMIFDGT
FT                   VRENIAYGRPGATEREIREAARAADAHEFIERLPQGYDTVVGQKGRLLSGGQRQRIAIA
FT                   RAMLRDAPVLVLDEPAAGLDAGSQERIMKPLRRLMAGRTTIVISHDLLAVREATRIVVL
FT                   EGGRVAGSGTHAELLERGGLYAGLFRRQSPERGAV"
     MGKTWRKRLR LGLGWLAGDM REGGGPVAAA PAMPLREILR RFWPHARPYR RWLVPLLLLA        60
     ALGPAVETAT IWMYKVLVDG VLIPGEFGLL PWVVLAYLGL TLLDGAISFL DGYLSEWVGG       120
     RFILRLRTGL FRHLQTLSLD FFDRRKLGDT VARISDDVEE IEELLLSGAV SAVTYAFQLL       180
     FFVGALFYLE WRLALVSLLV APLFWLVARR FSRRIKRAAR EERRKAGSIG AVAEESLSNA       240
     ALVQAYNRQE HEVARFHREN EEGFAAQMVA ARLSALFSPL VNLIELLGAL TVVSFGAYLL       300
     SRGALTVGGL LAFLVYLGML YRPIRGFSRL ANSFFSAAAA AERVAELLQM RPAVRGGALE       360
     PGRLRGEVRF REVTFRYPGA AEPALRGVSF EARPGEVVAL AGPSGAGKST VVRLLLRFYD       420
     PEGGSISIDG YELRELSLRA LRENVAVVLQ EAMIFDGTVR ENIAYGRPGA TEREIREAAR       480
     AADAHEFIER LPQGYDTVVG QKGRLLSGGQ RQRIAIARAM LRDAPVLVLD EPAAGLDAGS       540
     QERIMKPLRR LMAGRTTIVI SHDLLAVREA TRIVVLEGGR VAGSGTHAEL LERGGLYAGL       600
     FRRQSPERGA V                                                            611
//

If you have problems or comments...

PBIL Back to PBIL home page