(data stored in ACNUC7421 zone)

EMBL: CP000386.PE183

CP000386.PE183       Location/Qualifiers
FT   CDS             complement(188212..189642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0186"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /note="PFAM: ATP-binding region, ATPase-like histidine
FT                   kinase A-like; KEGG: gka:GK1689 two-component sensor
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03164"
FT                   /db_xref="GOA:Q1AZL4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZL4"
FT                   /protein_id="ABG03164.1"
FT                   /translation="MRWLRELREQSRYIIIAAVGWLLVAILVVGIVGLLENRNMKSVTD
FT                   RALRYDVELEDDADDLRAAILDLRHYHRNIYFGGPSRTQIENLEGAYRLVLSEISELER
FT                   LGVRDPDAPRPESLRRMAREYYADWRPAIDEYERTGNEDAFADASDLGVARLSRMEEAA
FT                   AELDKLGEQLSARSLQRVEAAATRARVVLLTVVGGLLVAGAGLAYAAVRMVGELRRLYA
FT                   EQRALARRLAELSRARTEFLADASHELRTPLTVLRGNAEVGLQLATEGEVREILQEIVG
FT                   EAGRMARMVEDMLFLARSEAASPPVEPRPVEAAPFLSSLADRAGALARERGARLEAGLS
FT                   AEGRLVLDRGRVEQAVLILVDNAAKYGRPGGRISLLARREAGELVIEVSDDGPGIPEEE
FT                   LPRIFERFYRVDKTRARRLGGAGLGLPIAKTIAEAHGGTLEARSRPGEGTTMTLRLPAA
FT                   PGELGAAPSLEASNPAHD"
     MRWLRELREQ SRYIIIAAVG WLLVAILVVG IVGLLENRNM KSVTDRALRY DVELEDDADD        60
     LRAAILDLRH YHRNIYFGGP SRTQIENLEG AYRLVLSEIS ELERLGVRDP DAPRPESLRR       120
     MAREYYADWR PAIDEYERTG NEDAFADASD LGVARLSRME EAAAELDKLG EQLSARSLQR       180
     VEAAATRARV VLLTVVGGLL VAGAGLAYAA VRMVGELRRL YAEQRALARR LAELSRARTE       240
     FLADASHELR TPLTVLRGNA EVGLQLATEG EVREILQEIV GEAGRMARMV EDMLFLARSE       300
     AASPPVEPRP VEAAPFLSSL ADRAGALARE RGARLEAGLS AEGRLVLDRG RVEQAVLILV       360
     DNAAKYGRPG GRISLLARRE AGELVIEVSD DGPGIPEEEL PRIFERFYRV DKTRARRLGG       420
     AGLGLPIAKT IAEAHGGTLE ARSRPGEGTT MTLRLPAAPG ELGAAPSLEA SNPAHD           476
//

If you have problems or comments...

PBIL Back to PBIL home page