(data stored in ACNUC7421 zone)

EMBL: CP000386.PE186

CP000386.PE186       Location/Qualifiers
FT   CDS             191530..192429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0189"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6,
FT                   transmembrane; KEGG: gsu:GSU2676 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03167"
FT                   /db_xref="GOA:Q1AZL1"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZL1"
FT                   /protein_id="ABG03167.1"
FT                   /translation="MPGARAVKRGGRPSARAGRLLILAGAVLWGTTGTAQAFAPPGADP
FT                   LSVGAVRIIVGGLALLAVAALRGELAGQRWPPLPVAVAACGIACYQPLFFAGVLETGVA
FT                   LGTIVAIGSAPVAAGAIGFVFRGERPGRRWAAATALAVLGCALLVGGGGGVSVEAGGIL
FT                   LALGAGFSYGVYATATKELLERLPYTAVMGVAFGLGALLLSPVLLFAAPGWLADPRGAA
FT                   VALELGLVATAAAYLLFARGLSAVPVSTAATLSLAEPLTAGLLGIAVLGERPGAASLAG
FT                   AALLLGGLALAAKGEEEG"
     MPGARAVKRG GRPSARAGRL LILAGAVLWG TTGTAQAFAP PGADPLSVGA VRIIVGGLAL        60
     LAVAALRGEL AGQRWPPLPV AVAACGIACY QPLFFAGVLE TGVALGTIVA IGSAPVAAGA       120
     IGFVFRGERP GRRWAAATAL AVLGCALLVG GGGGVSVEAG GILLALGAGF SYGVYATATK       180
     ELLERLPYTA VMGVAFGLGA LLLSPVLLFA APGWLADPRG AAVALELGLV ATAAAYLLFA       240
     RGLSAVPVST AATLSLAEPL TAGLLGIAVL GERPGAASLA GAALLLGGLA LAAKGEEEG        299
//

If you have problems or comments...

PBIL Back to PBIL home page