(data stored in ACNUC7421 zone)

EMBL: CP000386.PE187

CP000386.PE187       Location/Qualifiers
FT   CDS             complement(192426..192977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03168"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZL0"
FT                   /protein_id="ABG03168.1"
FT                   /translation="MRAALITALLAPALLLAGFAVGWVMAGEGWELTRGEERREPSAPE
FT                   PPPATSPRLPARDVSGADIPGLPRYPGSVRVAYVREPQGELVWTEVEYLTEARLERVRE
FT                   FYRDAFRTKGWAVGDVGFSQGAWVYFVMDGEREVILELQPRGRLVEVDMEMTEPAPPAA
FT                   RQPAPPPGDDADDAGDDDED"
     MRAALITALL APALLLAGFA VGWVMAGEGW ELTRGEERRE PSAPEPPPAT SPRLPARDVS        60
     GADIPGLPRY PGSVRVAYVR EPQGELVWTE VEYLTEARLE RVREFYRDAF RTKGWAVGDV       120
     GFSQGAWVYF VMDGEREVIL ELQPRGRLVE VDMEMTEPAP PAARQPAPPP GDDADDAGDD       180
     DED                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page