(data stored in ACNUC7421 zone)

EMBL: CP000386.PE191

CP000386.PE191       Location/Qualifiers
FT   CDS             196379..197248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0194"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG: bpa:BPP2196
FT                   putative ABC transport system, membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03172"
FT                   /db_xref="GOA:Q1AZK6"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZK6"
FT                   /protein_id="ABG03172.1"
FT                   /translation="MDLSALAVQVLAGLTYGMLLFMISVGLSVIFGLMGIVNLAHGVFF
FT                   VLGAYIAFSVLGGGAGFLIALVVAMVAMAVLGVLVERLLLFRSYGDELGQVLLTFGLAF
FT                   IIADVIKMIWGNRLQSLPTPSLLDFSVSVGGITFPVYRLVVVLVGCLLALLLWYLESRT
FT                   RIGAIIRAGVDDREMVAALGINVTLVFAGVFAFGAALAGLGGVLGGPVLGMYPDMGFEI
FT                   LVLSLIVVVLGGLGTWKGAFVGGVLVGLVEIFGQAYFPSLSLVIVFLLMAGVLLVRPAG
FT                   LFGRSPAS"
     MDLSALAVQV LAGLTYGMLL FMISVGLSVI FGLMGIVNLA HGVFFVLGAY IAFSVLGGGA        60
     GFLIALVVAM VAMAVLGVLV ERLLLFRSYG DELGQVLLTF GLAFIIADVI KMIWGNRLQS       120
     LPTPSLLDFS VSVGGITFPV YRLVVVLVGC LLALLLWYLE SRTRIGAIIR AGVDDREMVA       180
     ALGINVTLVF AGVFAFGAAL AGLGGVLGGP VLGMYPDMGF EILVLSLIVV VLGGLGTWKG       240
     AFVGGVLVGL VEIFGQAYFP SLSLVIVFLL MAGVLLVRPA GLFGRSPAS                   289
//

If you have problems or comments...

PBIL Back to PBIL home page