(data stored in ACNUC7421 zone)

EMBL: CP000386.PE192

CP000386.PE192       Location/Qualifiers
FT   CDS             197245..198258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0195"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG: bbr:BB1594
FT                   putative ABC transport system, membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03173"
FT                   /db_xref="GOA:Q1AZK5"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZK5"
FT                   /protein_id="ABG03173.1"
FT                   /translation="MTRATGTRVPWPGVAALALLVLLLPLALPAFGVGIATEIYVMAIF
FT                   AMSLGLIIGYAGLVSLGHAAFFGAGAYTVALLGERVSNTYVLVAAAVAVAALLACVSGA
FT                   LFFRSTGAYFLMLTLAFAQVLFAAAFQAESVTGGSDGMGVSVAPDLGFGEISGELGLYY
FT                   LMGGSFLLCYVLLRLFVSSPAGRVVRGIMENELRMRALGYNTFSYKLFAYTLAGGVAGF
FT                   AGALYSYFNLYVTPDLLGWVFSGQALIMVIVGGTGTLLGPAVGAAFFIVVRNYVSFYTE
FT                   YWALIMGLIFIFFVLLGRGGIVHLLQAGWRRLLAARAPRRPREGRSAAGSAKERAP"
     MTRATGTRVP WPGVAALALL VLLLPLALPA FGVGIATEIY VMAIFAMSLG LIIGYAGLVS        60
     LGHAAFFGAG AYTVALLGER VSNTYVLVAA AVAVAALLAC VSGALFFRST GAYFLMLTLA       120
     FAQVLFAAAF QAESVTGGSD GMGVSVAPDL GFGEISGELG LYYLMGGSFL LCYVLLRLFV       180
     SSPAGRVVRG IMENELRMRA LGYNTFSYKL FAYTLAGGVA GFAGALYSYF NLYVTPDLLG       240
     WVFSGQALIM VIVGGTGTLL GPAVGAAFFI VVRNYVSFYT EYWALIMGLI FIFFVLLGRG       300
     GIVHLLQAGW RRLLAARAPR RPREGRSAAG SAKERAP                                337
//

If you have problems or comments...

PBIL Back to PBIL home page