(data stored in ACNUC7421 zone)

EMBL: CP000386.PE195

CP000386.PE195       Location/Qualifiers
FT   CDS             complement(199713..200498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0198"
FT                   /product="6-phosphogluconate dehydrogenase, NAD-binding
FT                   protein"
FT                   /note="PFAM: 6-phosphogluconate dehydrogenase, NAD-binding;
FT                   KEGG: mag:amb0253 3-hydroxyisobutyrate dehydrogenase and
FT                   related beta-hydroxyacid dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03176"
FT                   /db_xref="GOA:Q1AZK2"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015814"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZK2"
FT                   /protein_id="ABG03176.1"
FT                   /translation="MSGGGHLAVLGLGEAGSEISADLAARGRRVLGYDIRPVEPPEGVE
FT                   LAGSPEEAARGADAVLALVPAADAPAAARSVLPVLGPGSLYADCSSASPRQKRELARMV
FT                   GRTGASFVDLTLMGTVPGRGLSTPAFVSGEGAGRLADLLRPLGMPVEEVSGEPGDAAGR
FT                   KLLRSVFVKGMTGAMMEALEAARAAGCEGWLWGNIVSELAGADEALARRLVEGSYRHAR
FT                   RRADEMAAAAELLRGLGVEPRITRAAEARLRELLEGGEA"
     MSGGGHLAVL GLGEAGSEIS ADLAARGRRV LGYDIRPVEP PEGVELAGSP EEAARGADAV        60
     LALVPAADAP AAARSVLPVL GPGSLYADCS SASPRQKREL ARMVGRTGAS FVDLTLMGTV       120
     PGRGLSTPAF VSGEGAGRLA DLLRPLGMPV EEVSGEPGDA AGRKLLRSVF VKGMTGAMME       180
     ALEAARAAGC EGWLWGNIVS ELAGADEALA RRLVEGSYRH ARRRADEMAA AAELLRGLGV       240
     EPRITRAAEA RLRELLEGGE A                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page