(data stored in ACNUC7421 zone)

EMBL: CP000386.PE196

CP000386.PE196       Location/Qualifiers
FT   CDS             complement(200495..201469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0199"
FT                   /product="Catechol 2,3-dioxygenase"
FT                   /EC_number="1.13.11.2"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: bja:blr3819 metapyrocatechase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03177"
FT                   /db_xref="GOA:Q1AZK1"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR017624"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZK1"
FT                   /protein_id="ABG03177.1"
FT                   /translation="MRGGEPVRDVAHLGHVELLTPAFEESLWFFTEVLGMEEVGRRGES
FT                   AYLRAFGDYELSTLKLTAADRAGPGHIAWRATSRAALERRVAALEESGLGEGWVEGDLG
FT                   HGPAYRFADPDGHVMELYFETEKYRPPEGLRPALKNQPQKFTARGVGVRRIDHVNLRAL
FT                   DIDANSAFMRERLGFRLTEEVRLDDGRQGAAWMNVTQKSYDIAYGGIDAAGMGGRLHHV
FT                   AYALDSREYVLRAADIFAEEGVFIEAGPAKHAVQQTFFLYVYEPGGNRVEMISDIKLLL
FT                   DPDPETVTWSQAEREKGQAWRTIMPESFFTYATPLPEEAGRRG"
     MRGGEPVRDV AHLGHVELLT PAFEESLWFF TEVLGMEEVG RRGESAYLRA FGDYELSTLK        60
     LTAADRAGPG HIAWRATSRA ALERRVAALE ESGLGEGWVE GDLGHGPAYR FADPDGHVME       120
     LYFETEKYRP PEGLRPALKN QPQKFTARGV GVRRIDHVNL RALDIDANSA FMRERLGFRL       180
     TEEVRLDDGR QGAAWMNVTQ KSYDIAYGGI DAAGMGGRLH HVAYALDSRE YVLRAADIFA       240
     EEGVFIEAGP AKHAVQQTFF LYVYEPGGNR VEMISDIKLL LDPDPETVTW SQAEREKGQA       300
     WRTIMPESFF TYATPLPEEA GRRG                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page