(data stored in ACNUC7421 zone)

EMBL: CP000386.PE202

CP000386.PE202       Location/Qualifiers
FT   CDS             205837..206664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0205"
FT                   /product="intradiol ring-cleavage dioxygenase"
FT                   /note="PFAM: intradiol ring-cleavage dioxygenase Catechol
FT                   dioxygenase-like; KEGG: atc:AGR_C_4592 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03183"
FT                   /db_xref="GOA:Q1AZJ5"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR007535"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZJ5"
FT                   /protein_id="ABG03183.1"
FT                   /translation="MVDSARVVRNERLARILPEALGALHEIIERHRITEREWLAVLDFL
FT                   TEVGRKDEFVLLSDVTRTSVLVDSITHEDGAATPSDVEGPLYRENPPWREKPVKIYEEY
FT                   EGIEEGDVLFVRGRVTSTDGTPLGGAILDVWQTGPTGGYDVWDERQPDYNFRGRFGVEE
FT                   DGSYEFQTMVPKPYTVPTDGPVGRLLEAIGQHPWRPAHIHFKVEAEGHETLTTQIFFPD
FT                   DPYLENDTIGAVKPELVRPLERHEDEEEISRRGLDGPFYTCDFDIKLKPAARG"
     MVDSARVVRN ERLARILPEA LGALHEIIER HRITEREWLA VLDFLTEVGR KDEFVLLSDV        60
     TRTSVLVDSI THEDGAATPS DVEGPLYREN PPWREKPVKI YEEYEGIEEG DVLFVRGRVT       120
     STDGTPLGGA ILDVWQTGPT GGYDVWDERQ PDYNFRGRFG VEEDGSYEFQ TMVPKPYTVP       180
     TDGPVGRLLE AIGQHPWRPA HIHFKVEAEG HETLTTQIFF PDDPYLENDT IGAVKPELVR       240
     PLERHEDEEE ISRRGLDGPF YTCDFDIKLK PAARG                                  275
//

If you have problems or comments...

PBIL Back to PBIL home page