(data stored in ACNUC7421 zone)

EMBL: CP000386.PE208

CP000386.PE208       Location/Qualifiers
FT   CDS             complement(211945..212910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0211"
FT                   /product="luciferase-like protein"
FT                   /note="PFAM: luciferase-like; KEGG: nfa:nfa43060
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03189"
FT                   /db_xref="GOA:Q1AZI9"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019952"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZI9"
FT                   /protein_id="ABG03189.1"
FT                   /translation="MAVKFGVFVPQGWRMDLTEIEDPAEQYEAMTRVARRADELDGYDS
FT                   IWVYDHFHTVPEPTRNTTFECWTITAGLARDTRRVKVGQMVTCNGYRNPALLAKMASTV
FT                   DVMSHGRLLFGLGAGWYEHEWRAYGYGFPDVPVRMRMFREACEIVHRMWTEDGAVFEGE
FT                   HYRIDRPINEPKGLQKPHPPFWIGGGGERVTLRLVARWGDACNVFGDPDTLRHKFGVLR
FT                   RHCEEVGRDYEEITRSTSVNVHLLEEGEDPEKATRRARGGRSYEEYAEQFRVGTPRQIV
FT                   SLLEERAEAGVEYFIVYLPRVAYDHTQLERFAEEVIPALS"
     MAVKFGVFVP QGWRMDLTEI EDPAEQYEAM TRVARRADEL DGYDSIWVYD HFHTVPEPTR        60
     NTTFECWTIT AGLARDTRRV KVGQMVTCNG YRNPALLAKM ASTVDVMSHG RLLFGLGAGW       120
     YEHEWRAYGY GFPDVPVRMR MFREACEIVH RMWTEDGAVF EGEHYRIDRP INEPKGLQKP       180
     HPPFWIGGGG ERVTLRLVAR WGDACNVFGD PDTLRHKFGV LRRHCEEVGR DYEEITRSTS       240
     VNVHLLEEGE DPEKATRRAR GGRSYEEYAE QFRVGTPRQI VSLLEERAEA GVEYFIVYLP       300
     RVAYDHTQLE RFAEEVIPAL S                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page