(data stored in ACNUC7421 zone)

EMBL: CP000386.PE209

CP000386.PE209       Location/Qualifiers
FT   CDS             complement(212981..213508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0212"
FT                   /product="ATP:cob(I)alamin adenosyltransferase"
FT                   /note="TIGRFAM: ATP; PFAM: regulatory protein GntR, HTH
FT                   cobalamin adenosyltransferase; KEGG: bur:Bcep18194_A3822
FT                   cobalamin adenosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03190"
FT                   /db_xref="GOA:Q1AZI8"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR016030"
FT                   /db_xref="InterPro:IPR029499"
FT                   /db_xref="InterPro:IPR036451"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZI8"
FT                   /protein_id="ABG03190.1"
FT                   /translation="MAESKPPVSTRRGDDGTTTLLGSGRLRKDDLRIAVLGEVDEASSF
FT                   LGLARAEAGEGELGDVILDTQRLLYRIMGDVAMPKEPNTVGEDDLRRVEERLEEWRSRT
FT                   ELPREFVVPGESRLGALLDVARSVVRRAERALVAAGYVEAHPQAVRAVNRLSDLLYILA
FT                   RAADGRSTPSRG"
     MAESKPPVST RRGDDGTTTL LGSGRLRKDD LRIAVLGEVD EASSFLGLAR AEAGEGELGD        60
     VILDTQRLLY RIMGDVAMPK EPNTVGEDDL RRVEERLEEW RSRTELPREF VVPGESRLGA       120
     LLDVARSVVR RAERALVAAG YVEAHPQAVR AVNRLSDLLY ILARAADGRS TPSRG            175
//

If you have problems or comments...

PBIL Back to PBIL home page