(data stored in ACNUC7421 zone)

EMBL: CP000386.PE214

CP000386.PE214       Location/Qualifiers
FT   CDS             218740..219744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0217"
FT                   /product="luciferase-like protein"
FT                   /note="PFAM: luciferase-like; KEGG: sme:SMb20100 putative
FT                   dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03195"
FT                   /db_xref="GOA:Q1AZI3"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019945"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZI3"
FT                   /protein_id="ABG03195.1"
FT                   /translation="MKITGTVGYAAMFEQFHPTDLLRWSRLAEENGFASVMASDHFHPW
FT                   TPEQGQSAFVWSWLGALGATTSLRFGTGVTPPGFRYHPAVIAQAAATLEAMYPGRFWLG
FT                   LGAGEALNEHIVGRYWPEAPTRLRILMESIEVIRRLFTGKKVKYQGEHVTLESARLYTL
FT                   PETPPPIYVATAGPIQSKRTGKYCDGIITVGASDEKIGMLMERFEEGAREAGKDPSQMP
FT                   RIVQLHVSWAESREEAEENALKEWPNGGMPFPKGDIRNPEDFQAMARFVRPEDFENRVL
FT                   ISADLDEHLEHVQHYIDLGFDEVYVHNVGRNQEEFIRAYGERVIPKLRWPEEG"
     MKITGTVGYA AMFEQFHPTD LLRWSRLAEE NGFASVMASD HFHPWTPEQG QSAFVWSWLG        60
     ALGATTSLRF GTGVTPPGFR YHPAVIAQAA ATLEAMYPGR FWLGLGAGEA LNEHIVGRYW       120
     PEAPTRLRIL MESIEVIRRL FTGKKVKYQG EHVTLESARL YTLPETPPPI YVATAGPIQS       180
     KRTGKYCDGI ITVGASDEKI GMLMERFEEG AREAGKDPSQ MPRIVQLHVS WAESREEAEE       240
     NALKEWPNGG MPFPKGDIRN PEDFQAMARF VRPEDFENRV LISADLDEHL EHVQHYIDLG       300
     FDEVYVHNVG RNQEEFIRAY GERVIPKLRW PEEG                                   334
//

If you have problems or comments...

PBIL Back to PBIL home page