(data stored in ACNUC7421 zone)

EMBL: CP000386.PE218

CP000386.PE218       Location/Qualifiers
FT   CDS             223765..225018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0221"
FT                   /product="Amidase, hydantoinase/carbamoylase"
FT                   /EC_number="3.5.1.87"
FT                   /note="KEGG: sai:Saci_2132 N-carbamoyl-L-amino acid
FT                   amidohydrolase; TIGRFAM: Amidase,
FT                   hydantoinase/carbamoylase; PFAM: peptidase M20"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03199"
FT                   /db_xref="GOA:Q1AZH9"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZH9"
FT                   /protein_id="ABG03199.1"
FT                   /translation="MRQTHGAVDPRRVIAELRELHRLTGGPEGAQRVAWTRTWREAREW
FT                   LEGKLEEIEGVTEIETDEAGNLWATAPGDSERAVLLGGHIDSVPNGGWLDGCLNTLAAV
FT                   EVLRALAPRRRPVTLRLVDWADEEGARFGRSLLGSSACSGSLDPEEVRGLRDRDGVALP
FT                   DALKENGVELDRMKESHRQLESAAAYLELHIEQGPVLERLGLPLGVVLGTFGVERHAVR
FT                   FAGQHAHSGSTPMDARRDAFIAAARAAVEFRDDARRRDDVRATTGFVNVSPGIVTAFNG
FT                   FCEMSLDQRALDAGVLADMLAKAKEASERVAAEEGVSVGWERLWQIEPRPFHPELIELA
FT                   DEAVREVAGSSHRLPSGPLHDAAEMAPLMPTVMLFVKSLRGLSHTKEEDTPEEDIELSV
FT                   RALYRLAEKTLGWAEQRG"
     MRQTHGAVDP RRVIAELREL HRLTGGPEGA QRVAWTRTWR EAREWLEGKL EEIEGVTEIE        60
     TDEAGNLWAT APGDSERAVL LGGHIDSVPN GGWLDGCLNT LAAVEVLRAL APRRRPVTLR       120
     LVDWADEEGA RFGRSLLGSS ACSGSLDPEE VRGLRDRDGV ALPDALKENG VELDRMKESH       180
     RQLESAAAYL ELHIEQGPVL ERLGLPLGVV LGTFGVERHA VRFAGQHAHS GSTPMDARRD       240
     AFIAAARAAV EFRDDARRRD DVRATTGFVN VSPGIVTAFN GFCEMSLDQR ALDAGVLADM       300
     LAKAKEASER VAAEEGVSVG WERLWQIEPR PFHPELIELA DEAVREVAGS SHRLPSGPLH       360
     DAAEMAPLMP TVMLFVKSLR GLSHTKEEDT PEEDIELSVR ALYRLAEKTL GWAEQRG          417
//

If you have problems or comments...

PBIL Back to PBIL home page