(data stored in ACNUC7421 zone)

EMBL: CP000386.PE22

CP000386.PE22        Location/Qualifiers
FT   CDS             complement(23672..25186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0022"
FT                   /product="Peptidoglycan glycosyltransferase"
FT                   /EC_number="2.4.1.129"
FT                   /note="PFAM: penicillin-binding protein, transpeptidase;
FT                   KEGG: tte:TTE1967 cell division protein
FT                   FtsI/penicillin-binding protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03003"
FT                   /db_xref="GOA:Q1B025"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q1B025"
FT                   /protein_id="ABG03003.1"
FT                   /translation="MNAHVRRTFYLFVAGFVALIGMLAYWQVYARESLANNPENGLQTR
FT                   RAIESPRGLILARDGETVLARSVKQPSESGNPTYERVYPQGPLYAGVVGYWSTRYGATG
FT                   IEIAENSSLSGTADPATLDELINQISGGPRPGNNVILTIDPQLQRLAYELLAASNTGRG
FT                   SAVAVDPETGEVLALVSHPSYDPNNIDERFRELQQDPSQPLLNRATQGLYPPGSVFKVV
FT                   TAAAALKSGVSPSDVFFDDGTYEQPGYTVTNYGGASYGRVTFAQALALSINTVFARVAV
FT                   EEVGRQMLYATARDFGFGSSYEEFPLEVSASRLGEGNLAQIAFGQDTVLSNVFQMALVA
FT                   ATVANDGTMMEPHLVREVRSPDGIIIERTSPQREREVLDPQTAGTLQQMMVGVVESGSA
FT                   TAAQIPGVEVAGKTGTAEVPPNAPHSWFIAFAPADDPQIAVAVLVENGGDGEKQALPIA
FT                   RQLIASYLDLPSRPRRGPQLPENLPQQLPEELQGLPQRLFGENGRP"
     MNAHVRRTFY LFVAGFVALI GMLAYWQVYA RESLANNPEN GLQTRRAIES PRGLILARDG        60
     ETVLARSVKQ PSESGNPTYE RVYPQGPLYA GVVGYWSTRY GATGIEIAEN SSLSGTADPA       120
     TLDELINQIS GGPRPGNNVI LTIDPQLQRL AYELLAASNT GRGSAVAVDP ETGEVLALVS       180
     HPSYDPNNID ERFRELQQDP SQPLLNRATQ GLYPPGSVFK VVTAAAALKS GVSPSDVFFD       240
     DGTYEQPGYT VTNYGGASYG RVTFAQALAL SINTVFARVA VEEVGRQMLY ATARDFGFGS       300
     SYEEFPLEVS ASRLGEGNLA QIAFGQDTVL SNVFQMALVA ATVANDGTMM EPHLVREVRS       360
     PDGIIIERTS PQREREVLDP QTAGTLQQMM VGVVESGSAT AAQIPGVEVA GKTGTAEVPP       420
     NAPHSWFIAF APADDPQIAV AVLVENGGDG EKQALPIARQ LIASYLDLPS RPRRGPQLPE       480
     NLPQQLPEEL QGLPQRLFGE NGRP                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page