(data stored in ACNUC7421 zone)

EMBL: CP000386.PE223

CP000386.PE223       Location/Qualifiers
FT   CDS             230710..231498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0226"
FT                   /product="cobalt transport protein"
FT                   /note="PFAM: cobalt transport protein; KEGG: mta:Moth_0708
FT                   cobalt transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03204"
FT                   /db_xref="GOA:Q1AZH4"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZH4"
FT                   /protein_id="ABG03204.1"
FT                   /translation="MSRMDPYLYLDRDTPVHRLDPRAKMFLLLGAFVLAFLFPDPLYGL
FT                   GVLGLVLCFGHAARSLANLRRIWFILAMIAVMTVLLWSVFGGGRTPLLWFVELEPVLYG
FT                   LGTALRIDNTIIAGMIFLSTTRNEEIATGLVRLGIPYRFAFAVSTALRLVPTIIATGST
FT                   IGQAQRSRGLDLDSGGVIQRVRKRIPLLVPVFVSTIRSTSVFSMALESKGFGVAPRRTY
FT                   FLQLSVRRGDVVAMAVMAVLVAGAVALRLAGYGGVEGFSR"
     MSRMDPYLYL DRDTPVHRLD PRAKMFLLLG AFVLAFLFPD PLYGLGVLGL VLCFGHAARS        60
     LANLRRIWFI LAMIAVMTVL LWSVFGGGRT PLLWFVELEP VLYGLGTALR IDNTIIAGMI       120
     FLSTTRNEEI ATGLVRLGIP YRFAFAVSTA LRLVPTIIAT GSTIGQAQRS RGLDLDSGGV       180
     IQRVRKRIPL LVPVFVSTIR STSVFSMALE SKGFGVAPRR TYFLQLSVRR GDVVAMAVMA       240
     VLVAGAVALR LAGYGGVEGF SR                                                262
//

If you have problems or comments...

PBIL Back to PBIL home page