(data stored in ACNUC7421 zone)

EMBL: CP000386.PE226

CP000386.PE226       Location/Qualifiers
FT   CDS             233750..234748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0229"
FT                   /product="thioredoxin reductase"
FT                   /note="TIGRFAM: thioredoxin reductase; PFAM: FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase HI0933-like
FT                   protein; KEGG: mpa:MAP4339 thioredoxin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03207"
FT                   /db_xref="GOA:Q1AZH1"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZH1"
FT                   /protein_id="ABG03207.1"
FT                   /translation="MSEQYDVVVVGSGPAGYTAALYAARANLRTLVFQGFEAGGQLMLT
FT                   TDVENYPGYPEGVTGPEMMEDFERQAARFGAEMRPDNVDRVDFSGRPFRLWAEGQEEPV
FT                   LARAVIVATGAKARWLGLPGEQRLMGRGVSGCATCDGFFFKDKRVAVVGGGDTAMEEAL
FT                   FLSRYASEVVIIHRRDEFRASKIMLGRARKNPKISFITDTVVTDVLGEDAVEGLSLRNV
FT                   KTGEESTLEVEGFFVAIGHDPATEIFRGQLEMDEGGYLLQKEHTMTSVPGVFAAGDVAD
FT                   RRYRQAVTAAGDGCRAAIDAERWLEEQGEAQEAEDPGVWTAGKDRSPAGSG"
     MSEQYDVVVV GSGPAGYTAA LYAARANLRT LVFQGFEAGG QLMLTTDVEN YPGYPEGVTG        60
     PEMMEDFERQ AARFGAEMRP DNVDRVDFSG RPFRLWAEGQ EEPVLARAVI VATGAKARWL       120
     GLPGEQRLMG RGVSGCATCD GFFFKDKRVA VVGGGDTAME EALFLSRYAS EVVIIHRRDE       180
     FRASKIMLGR ARKNPKISFI TDTVVTDVLG EDAVEGLSLR NVKTGEESTL EVEGFFVAIG       240
     HDPATEIFRG QLEMDEGGYL LQKEHTMTSV PGVFAAGDVA DRRYRQAVTA AGDGCRAAID       300
     AERWLEEQGE AQEAEDPGVW TAGKDRSPAG SG                                     332
//

If you have problems or comments...

PBIL Back to PBIL home page