(data stored in ACNUC7421 zone)

EMBL: CP000386.PE228

CP000386.PE228       Location/Qualifiers
FT   CDS             236802..237518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0231"
FT                   /product="phosphoesterase, PA-phosphatase related"
FT                   /note="PFAM: phosphoesterase, PA-phosphatase related; KEGG:
FT                   sat:SYN_02354 phosphatidylglycerophosphatase B -like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03209"
FT                   /db_xref="GOA:Q1AZG9"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZG9"
FT                   /protein_id="ABG03209.1"
FT                   /translation="MLGKLREALPGSSSALFGRMTLAAAVWLAAGLGLSAFVIWAFAGI
FT                   AEEVVEGDTRRFDRAVLLWIHTHFPGWLEGPMRAVTALGYYRVVVPLLAVCVAVFFLKG
FT                   WRLSAVLLAVSTAGGMFLTTVLKAVFQRARPELFQSGYEAGFYSFPSGHATVAVGFYGM
FT                   LTLILAYRARGALRWLVAALGAALVVLIGFSRLYLGVHYPTDVLAGYLSAPLWVVCVGI
FT                   LYVVWLSVRGLRGKGG"
     MLGKLREALP GSSSALFGRM TLAAAVWLAA GLGLSAFVIW AFAGIAEEVV EGDTRRFDRA        60
     VLLWIHTHFP GWLEGPMRAV TALGYYRVVV PLLAVCVAVF FLKGWRLSAV LLAVSTAGGM       120
     FLTTVLKAVF QRARPELFQS GYEAGFYSFP SGHATVAVGF YGMLTLILAY RARGALRWLV       180
     AALGAALVVL IGFSRLYLGV HYPTDVLAGY LSAPLWVVCV GILYVVWLSV RGLRGKGG         238
//

If you have problems or comments...

PBIL Back to PBIL home page